2.77 Rating by CuteStat

It is a domain having cc extension. It has a global traffic rank of #9619584 in the world. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, campusconnect.cc is SAFE to browse.

PageSpeed Score
66
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: 50
Daily Pageviews: 100

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 9,619,584
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

174.138.173.243

Hosted Country:

United States of America US

Location Latitude:

33.4979

Location Longitude:

-112.081

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 2 H2 Headings: 2
H3 Headings: 4 H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 12
Google Adsense: Not Applicable Google Analytics: UA-68301048-1

Websites Hosted on Same IP (i.e. 174.138.173.243)

Frommer's Travel Guides: Trip Ideas, Inspiration & Deals

- frommers.com

The essential destination for planning the perfect travel excursion. Read candid, timely articles from Frommer's travel guide experts, browse Guidebooks, get insights from our lively message boards, and purchase travel products and services.

31,107 $ 467,280.00


PC GAMES - Wissen, was gespielt wird!

- schueler.cc
82,869 $ 175,680.00

ERROR: The request could not be satisfied

- thedrum.co.uk
5,408,659 $ 240.00

Economie | NU - Het laatste nieuws het eerst op NU.nl

- nuzakelijk.nl
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Fri, 09 Jun 2017 17:50:11 GMT
Expires: Fri, 09 Jun 2017 18:00:11 GMT
Cache-Control: public, max-age=600
ETag: "JUdTRQ"
X-Cloud-Trace-Context: 1cc7fb522ae3f30166ef81787ebf84d2
Content-Type: text/html
Transfer-Encoding: chunked
Server: Google Frontend

Domain Nameserver Information

Host IP Address Country
ns45.domaincontrol.com 97.74.102.23 United States of America United States of America
ns46.domaincontrol.com 173.201.70.23 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
campusconnect.cc A 3591 IP: 174.129.25.170
campusconnect.cc NS 3599 Target: ns46.domaincontrol.com
campusconnect.cc NS 3599 Target: ns45.domaincontrol.com
campusconnect.cc SOA 3599 MNAME: ns45.domaincontrol.com
RNAME: dns.jomax.net
Serial: 2016101900
Refresh: 28800
Retry: 7200
Expire: 604800
Minimum TTL: 600
campusconnect.cc MX 1799 Priority: 10
Target: mx.zoho.com
campusconnect.cc MX 1799 Priority: 20
Target: mx2.zoho.com
campusconnect.cc TXT 3599 TXT: globalsign-domain-verification=vVNUJEiPJ
niKDdoWicJuKMf9V52-vb9KovoAIiiida
campusconnect.cc TXT 3599 TXT: firebase=campusconnect-650e6
campusconnect.cc TXT 3599 TXT: google-site-verification=yUn2BKZdb3Fzc4o
-ZoQFwUlb_dbTZt5NNFciEdd9aI0
campusconnect.cc AAAA 3599 IPV6: 2001:4860:4802:32::15
campusconnect.cc AAAA 3599 IPV6: 2001:4860:4802:34::15
campusconnect.cc AAAA 3599 IPV6: 2001:4860:4802:36::15
campusconnect.cc AAAA 3599 IPV6: 2001:4860:4802:38::15

Similarly Ranked Websites

403 Forbidden

- bucievola.com
9,619,596 $ 240.00

404 Not Found.

- evhanimlarindanyemektarifleri.com
9,619,613 $ 240.00

403 Forbidden

- repairgreatlyfreetheproduct.vip
9,619,634 $ 240.00

Insurance | Farmers & Mercantile | UK

- fandmgroup.co.uk

Contact Farmers & Mercantile, UK-wide insurance brokers, for a quality service from an experienced team that will help you find the right insurance policy.

9,619,635 $ 240.00

Morocco Tours | Marrakech|Merzouga

- greatsaharatours.com

We offers affordable trips whether you want to tour the desert and take a camel trek to see the stars in the Sahara, Explore the Imperial Cities of Casablanca and Meknes and Rabat , 3 Days tour from Marrakech to Fez, Days tour from Fez, Desert Tours and Atlas Mountains, Go shopping in the colourful souks of Marrakech a

9,619,643 $ 240.00

Full WHOIS Lookup

Domain Name: CAMPUSCONNECT.CC
Domain ID: 114463734
WHOIS Server: whois.godaddy.com
Referral URL: http://www.godaddy.com
Updated Date: 2016-07-26T10:23:27Z
Creation Date: 2015-08-30T17:12:44Z
Registry Expiry Date: 2017-08-30T17:12:44Z
Sponsoring Registrar: GODADDY.COM, LLC
Sponsoring Registrar IANA ID: 146
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS45.DOMAINCONTROL.COM
Name Server: NS46.DOMAINCONTROL.COM
DNSSEC: unsigned
>>> Last update of WHOIS database: 2017-06-09T17:50:11Z